PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G309100.1.p
Common NameLOC101779662, SETIT_030809mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 269aa    MW: 28077.2 Da    PI: 4.6702
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G309100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.64.5e-23179223145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         ++epgrCrRtDGKkWRC+r +++++k+CErH+hrgr+r  + ++e
  Seita.2G309100.1.p 179 EPEPGRCRRTDGKKWRCWRSTIPNEKYCERHMHRGRKRPVQLVVE 223
                         69************************************9998875 PP

2QLQ54.34.2e-19113148237
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  Seita.2G309100.1.p 113 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 148
                         8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-8112148IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.922113148IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.3E-12113147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.471179223IPR014977WRC domain
PfamPF088791.0E-19180218IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAAEGEAKNP SGGGGGGGGG GDNPQLEAAP VAPAPAEGEA LQEAVAQGTG QESEGEKADR  60
EGEKDDGACR DLVLVEDPEA VAVEDPEEAA AIAALQEEMK ALVASIPDGA GAAFTAMQLQ  120
ELEQQSRVYQ YMAARVPVPT HLVFPIWKSV TGASSEGAQK YPTLMGLATL CLDFGKNPEP  180
EPGRCRRTDG KKWRCWRSTI PNEKYCERHM HRGRKRPVQL VVEDNEPDSA SGSKSTPGKA  240
TEGAKKADDK TPSSKKLAVA APAAVQST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425130.0BT042513.1 Zea mays full-length cDNA clone ZM_BFb0310G14 mRNA, complete cds.
GenBankBT0874370.0BT087437.1 Zea mays full-length cDNA clone ZM_BFb0076N13 mRNA, complete cds.
GenBankEF5158490.0EF515849.1 Zea mays putative growth-regulating factor 10 (GRF10) mRNA, complete cds.
GenBankEU9606010.0EU960601.1 Zea mays clone 226522 growth-regulating factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957654.10.0PREDICTED: growth-regulating factor 11-like
SwissprotQ6AWX81e-130GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLK3ZW280.0K3ZW28_SETIT; Uncharacterized protein
STRINGSi030809m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.17e-31growth-regulating factor 2